PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.D00490.1.p
Common NameEUGRSUZ_D00490, LOC104440901
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family Dof
Protein Properties Length: 193aa    MW: 21675.6 Da    PI: 9.6337
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.D00490.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.51.4e-3874132260
            zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60 
                       ++k+++cprC+s++tkfCy+nny+++qPr+fCk+C+ryWt+GGalrnvPvG+grrk+k 
  Eucgr.D00490.1.p  74 PDKIIPCPRCKSMETKFCYFNNYNVNQPRHFCKGCQRYWTAGGALRNVPVGAGRRKSKP 132
                       68999***************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2973131IPR003851Zinc finger, Dof-type
PfamPF027015.3E-3276131IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.42578132IPR003851Zinc finger, Dof-type
PROSITE patternPS01361080116IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010214Biological Processseed coat development
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MANPSHGVQD SKGIKLFGAT ITLQGFRDQQ VKSEAPISTE ATTTMTTMTT TTKMAMISTT  60
NRNQDALAEA MKRPDKIIPC PRCKSMETKF CYFNNYNVNQ PRHFCKGCQR YWTAGGALRN  120
VPVGAGRRKS KPPCRGMDGF PESCSFEGSE VNHHQYYDLD YGVVENWHQL VPQGAFQHVV  180
RVKRRRNGDQ SY*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00166DAPTransfer from AT1G29160Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.D00490.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010052194.11e-147PREDICTED: dof zinc finger protein DOF1.5
SwissprotP683503e-56DOF15_ARATH; Dof zinc finger protein DOF1.5
TrEMBLA0A059CCD21e-147A0A059CCD2_EUCGR; Uncharacterized protein
STRINGVIT_10s0003g01260.t012e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM28092669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29160.14e-55Dof family protein